Live·Open questions in longevity research
Human Preservation Rating

MyHeritage DNA

GenomeRated Jun 18, 2026Website ↗
Continuity
36.1/ 100

How much of the actual person could plausibly continue or be brought back.

Legacy
40.4/ 100

How richly others can remember, reconstruct, or study the person later.

What this preserves

Consumer DNA testing connected to genealogy records.

Public dimension scores

We show only high-confidence dimensions here. Lower-confidence machine calls stay internal until the evidence is good enough. That keeps hallucinations minimized.

7 dimensions withheld by the public confidence gate.

Coverage breadth

3.0/ 10

Coverage is narrow. The facet map supports genome and genealogy; it does not support body, brain, memories, personality, likeness, voice, beliefs, or behavior.

Confidence: high

Facet coverage

Body

Not shown

Physical body or tissue substrate preservation.

Fidelity0.0 / 10

The evidence describes consumer DNA testing, genetic genealogy results, and family-history search. It does not show preservation of a body, tissue, or other physical substrate.

Brain / connectome

Not shown

Brain structure, connectome, or neural substrate preservation.

Fidelity0.0 / 10

No fetched evidence mentions brain tissue, neural structure, connectomes, or any brain-preservation service.

Genome

Covered

Genetic blueprint preservation.

Fidelity7.0 / 10

The evidence supports retention and use of DNA test data and genetic genealogy results. That is genome-related preservation, although the exact genomic substrate retained and storage details are not shown.

Memories

Not shown

Autobiographical memories and life stories.

Fidelity0.0 / 10

The fetched evidence does not show storage of autobiographical memories, journals, or life-story records.

Personality

Not shown

Stable traits, conversational style, preferences, and temperament.

Fidelity0.0 / 10

No evidence shows preservation of temperament, conversational style, or stable personal traits.

Social graph

Not shown

Relationships, affiliations, and interaction history.

Fidelity0.0 / 10

The evidence points to genealogy and family-history records, not a broader relationship graph or interaction history. Family lineage is covered better under genealogy.

Likeness

Not shown

Face, image, video, avatar, or visual representation.

Fidelity0.0 / 10

No fetched evidence shows face, image, video, avatar, or visual-representation preservation tied to this company offering.

Voice

Not shown

Voice recordings or voice model representation.

Fidelity0.0 / 10

No fetched evidence shows voice recordings or voice-model preservation.

Values / beliefs

Not shown

Stated values, beliefs, commitments, and opinions.

Fidelity0.0 / 10

The evidence does not show storage or modeling of beliefs, commitments, or opinions.

Genealogy

Covered

Lineage, ancestry, family records, and inherited identity.

Fidelity8.0 / 10

This is directly supported. The company sells DNA testing tied to genealogy services, historical-record search, and genealogy-linked family-history data.

Behavioral preferences

Not shown

Choices, habits, tastes, and behavior patterns.

Fidelity0.0 / 10

No fetched evidence shows preservation of habits, tastes, choices, or behavior patterns.

Structured evidence

No structured public evidence has been extracted yet.

Evidence sources

  1. Wayback snapshot 20060104
    wayback snapshotwaybackweb.archive.orgJan 4, 2006
  2. Wayback snapshot 20050125
    wayback snapshotwaybackweb.archive.orgJan 25, 2005
  3. Wayback snapshot 20040206
    wayback snapshotwaybackweb.archive.orgFeb 6, 2004
  4. Wayback snapshot 20030923
    wayback snapshotwaybackweb.archive.orgSep 23, 2003
  5. Wayback snapshot 20020122
    wayback snapshotwaybackweb.archive.orgJan 22, 2002
  6. What's wrong with MyHeritage DNA in Israel? - Facebook
    wikipediawikipediafacebook.com

    Tracing the Tribe - Jewish Genealogy on Facebook | Whats wrong with MyHeritageDNA

  7. MyHeritage Wiki
    wikipediawikipediamyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660004017514-5429745374269574

  8. About MyHeritage | Company History and Culture
    about pageabout pagemyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660004017514-8119167995678860

  9. MyHeritage DNA
    websitewebsitemyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660004017514-4153465777492107

  10. What's New with AncestryDNA and MyHeritage DNA - YouTube
    videospeeches youtubeyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  11. LiveMemory™ Video Ownership, Responsibility and Your Privacy
    tos privacytos privacymyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660004017514-7742529428590733

  12. LiveMemory™ Video Ownership, Responsibility and Your Privacy ...
    tos privacytos privacymyheritage.com

    Request unsuccessful. Incapsula incident ID: 7233000660004017514-5274057104756870

  13. Myheritage DNA Results - Brazilian (from Porto Seguro) - YouTube
    news articlepress generalyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  14. These People Just Got Their MyHeritage DNA Results - YouTube
    podcastspeeches podcastsyoutube.com

    - YouTube Info Presse Urheberrecht Kontakt Creator Werben Entwickler Impressum Verträge hier kündigen Nutzungsbedingungen Datenschutz Richtlinien & Sicherheit Wie funktioniert YouTube? Neue Funktionen testen © 2026 Google LLC

  15. What's New with AncestryDNA and MyHeritage DNA
    podcastspeeches podcastsfamilytreemagazine.com

    What's New with AncestryDNA and MyHeritage DNA - An Interview with Diahan Southard - Family Tree Magazine --> Buy Digital Membership Subscribe to Print --> --> LOG IN SIGNUP / MENU MENU Get Started Explore by Topic Record Types Birth, Marriage, Death + Divorce Census Church…

  16. MyHeritage - Wikipedia
    interviewinterviewen.wikipedia.org

    MyHeritage - Wikipedia Jump to content Main menu Main menu move to sidebar hide Navigation Main page Contents Current events Random article About Wikipedia Contact us Contribute Help Learn to edit Community portal Recent changes Upload file Special pages Search Search Appearance…